Recombinant Human ATP5B, His-tagged

• Cat.No.: ATP5B-26425TH
• Product Overview: Recombinant fragment, corresponding to amino acids 156-529 of Human ATPB, with N terminal His tag, 374 amino acids, MWt 45kDa, ,

Specification

• Description: This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitution with 143 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAP YAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVF AGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQ MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRF TQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR AIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKI LQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLS QPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLP EQAFYMVGPIEEAVAKADKLAEEHSS
• Sequence Similarities: Belongs to the ATPase alpha/beta chains family.

Gene Information

• Gene Name: ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [ Homo sapiens ]
• Official Symbol: ATP5B
• Synonyms: ATP5B; ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide; ATPSB; ATP synthase subunit beta, mitochondrial
• Gene ID: 506
• mRNA Refseq: NM_001686
• Protein Refseq: NP_001677
• MIM: 102910
• Uniprot ID: P06576
• Chromosome Location: 12p13.3
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem
• Function: ATP binding; contributes_to ATPase activity; MHC class I protein binding; calcium ion binding; eukaryotic cell surface binding

Reviews

05/22/2020

The outstanding quality of proteins lies in their strong biological activity and their high purity during production, which is really rare.

04/25/2020

ATP5B has a very short half-life and shows a very high clearance rate, which makes its biological activity more stable.

04/07/2019

Because the production process is efficient and environmentally friendly, recombinant proteins can be produced on a large scale without negative environmental impacts.

Q&As

What is the frequency of ATP5B mutations?

ATP5B gene mutation frequency may be different in different diseases and populations, which needs further study.

How about the link between ATP5B protein and neurological diseases?

It plays an important role in the nervous system and is associated with certain nervous system diseases such as Parkinson's disease and cerebral ischemia.

How are ATP5B mutations associated with disease?

This gene mutations may lead to abnormal protein structure or function, which in turn affects the physiological function of the protein and is associated with specific diseases.

What are the regulatory mechanisms of ATP5B?

ATP5B expression and function are affected by a variety of regulatory mechanisms, including regulation of transcription factors and epigenetic modifications.

How to evaluate the effect of ATP5B gene mutation on disease?

Assessment of the effect of ATP5B mutations on disease often requires a comprehensive analysis of gene sequencing, protein function studies, and clinical and epidemiological studies.

In which tissues or organs is ATP5B highly expressed?

It is highly expressed in multiple tissues and organs, especially metabolically active tissues such as heart, liver, and brain.