Recombinant Human C, His-tagged
Cat.No. : | C-30019TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-126 of Human PGEA1 with an N terminal His tag. Observed mol wt: 23 kDa ; |
- Specification
- Gene Information
- Related Products
Description : | Beta-catenin is a transcriptional activator and oncoprotein involved in the development of several cancers. The protein encoded by this gene interacts directly with the C-terminal region of beta-catenin, inhibiting oncogenic beta-catenin-mediated transcriptional activation by competing with transcription factors for binding to beta-catenin. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 108 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEY GSPTMNLAGQSLKFENGQWIAETGVSGGVDRREVQRLR RRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKRK |
Gene Name : | CBY1 chibby homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol : | CF8">C |
Synonyms : | C; chib; C22orf2, chromosome 22 open reading frame 2 , PGEA1, PKD2 interactor, golgi and endoplasmic reticulum associated 1; protein chibby homolog 1; Cby; Chibby; PIGEA 14; PIGEA14; |
Gene ID : | 25776 |
mRNA Refseq : | NM_001002880 |
Protein Refseq : | NP_001002880 |
MIM : | 607757 |
Uniprot ID : | Q9Y3M2 |
Chromosome Location : | 22q12 |
Pathway : | Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; |
Function : | beta-catenin binding; identical protein binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
C-1809J | Recombinant JEV C Protein | +Inquiry |
C-1811Y | Recombinant YEV C Protein | +Inquiry |
C-1127M | Recombinant Mouse C Protein, His (Fc)-Avi-tagged | +Inquiry |
C-1810R | Recombinant RuV (Strain TO-336) C Protein | +Inquiry |
C-02H | Recombinant HBV Core Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket