Recombinant Human C4ORF3 Protein (1-44 aa), His-SUMO-tagged
Cat.No. : | C4ORF3-1071H |
Product Overview : | Recombinant Human C4ORF3 Protein (1-44 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | His-SUMO |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 20.8 kDa |
Protein length : | 1-44 aa |
AA Sequence : | MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name : | C4orf3 chromosome 4 open reading frame 3 [ Homo sapiens ] |
Official Symbol : | C4ORF3 |
Gene ID : | 401152 |
mRNA Refseq : | NM_001170330.1 |
Protein Refseq : | NP_001163801.1 |
UniProt ID : | Q8WVX3 |
Products Types
◆ Recombinant Protein | ||
C4orf3-1869H | Recombinant Human C4orf3 Protein, MYC/DDK-tagged | +Inquiry |
C4orf3-129H | Recombinant Human C4orf3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket