Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human C4ORF3 Protein (1-44 aa), His-SUMO-tagged

Cat.No. : C4ORF3-1071H
Product Overview : Recombinant Human C4ORF3 Protein (1-44 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
Source : E. coli
Species : Human
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 20.8 kDa
Protein length : 1-44 aa
AA Sequence : MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name : C4orf3 chromosome 4 open reading frame 3 [ Homo sapiens ]
Official Symbol : C4ORF3
Gene ID : 401152
mRNA Refseq : NM_001170330.1
Protein Refseq : NP_001163801.1
UniProt ID : Q8WVX3

Products Types

◆ Recombinant Protein
C4orf3-1869H Recombinant Human C4orf3 Protein, MYC/DDK-tagged +Inquiry
C4orf3-129H Recombinant Human C4orf3 Protein, MYC/DDK-tagged, C13 and N15-labeled +Inquiry

See All C4ORF3 Recombinant Protein

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends