Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human C5, His-tagged

Cat.No. : C5-26131TH
Product Overview : Recombinant fragment, corresponding to amino acids 678-750 of Human C5 / C5a desArg with an N terminal His tag and tev protease sequence, 101 amino acids, predicted MW 11.3 kDa
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is the fifth component of complement, which plays an important role in inflammatory and cell killing processes. This protein is comprised of alpha and beta polypeptide chains that are linked by a disulfide bridge. An activation peptide, C5a, which is an anaphylatoxin that possesses potent spasmogenic and chemotactic activity, is derived from the alpha polypeptide via cleavage with a convertase. The C5b macromolecular cleavage product can form a complex with the C6 complement component, and this complex is the basis for formation of the membrane attack complex, which includes additional complement components. Mutations in this gene cause complement component 5 deficiency, a disease where patients show a propensity for severe recurrent infections. Defects in this gene have also been linked to a susceptibility to liver fibrosis and to rheumatoid arthritis.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute the vial by injection of 0.5 ml distilled or de-ionised water. Store stock solution after reconstitution in aliquots at -20°C. Repeated freeze and thaw cycles cause loss of activity.For dilutions use protein stabilized phosphate b
Storage buffer : Preservative: NoneConstituents: PBS
Storage : Store at +4°C.
Sequences of amino acids : MRGSHHHHHHGSDYDIPTTENLYFQGGSTLQKKIEEIAAK YKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKA FTECCVVASQLRANISHKDMQLG (His-tag is underlined, bold sequence is tev protease)
Gene Name : C5 complement component 5 [ Homo sapiens ]
Official Symbol : C5
Synonyms : C5; complement component 5; complement C5; CPAMD4;
Gene ID : 727
mRNA Refseq : NM_001735
Protein Refseq : NP_001726
MIM : 120900
Uniprot ID : P01031
Chromosome Location : 9q33-q34
Pathway : Activation of C3 and C5, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem;
Function : C5a anaphylatoxin chemotactic receptor binding; chemokine activity; endopeptidase inhibitor activity; receptor binding;

Products Types

◆ Recombinant Protein
C5-0053H Recombinant Human C5 Protein (G981-Q1306), His tagged +Inquiry
C5-346R Recombinant Rat C5 Protein, His-tagged +Inquiry
C5-347R Recombinant Rat C5 Protein, His-tagged +Inquiry
C5-344H Recombinant Human C5 Protein, His-tagged +Inquiry
C5-345H Recombinant Human C5 Protein, His-tagged +Inquiry

See All C5 Recombinant Protein

◆ Native Protein
C5-10540H Active Native Human C5 +Inquiry
C5-53H Native Human Complement C5 +Inquiry

See All C5 Native Protein

◆ Lysates
C5-8020HCL Recombinant Human C5 293 Cell Lysate +Inquiry

See All C5 Lysates

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends