Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DEFB103A protein

Cat.No. : DEFB103A-84H
Product Overview : Recombinant Human DEFB103A protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Defensins (alpha and beta) are cationic peptides with antimicrobial activity against Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses. They are 2-6 kDa proteins and take important roles in innate immune system. On the basis of their size and pattern of disulfide bonding, mammalian defensins are classified into alpha, beta and theta categories. β-Defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. Four human β-defensins have been identified and they are expressed on some leukocytes and at epithelial surfaces. Because β-defensins is cationic peptides, they can therefore interact with the membrane of invading microbes, which are negative due to lipopolysaccharides (LPS) and lipoteichoic acid (LTA) found in the cell membrane. Especially, they have higher affinity to the binding site compared to Ca2+ and Mg2+ ions. Furthermore, they can affect the stability of the membrane.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by anti-microbial activity against E.coli. is less than 30 μg/ml, corresponding to a specific activity of > 33.3 IU/mg.
Molecular Mass : Approximately 5.2 kDa, a single non-glycosylated polypeptide chain containing 45 amino acids.
Protein length : 45
AA Sequence : GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Endotoxin : Less than 1 EU/µg of rHuBD-3 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Publication :
Antimicrobial Peptide Resistance Mechanism Contributes to Staphylococcus aureus Infection (2018)
Gene Name : DEFB103A
Official Symbol : DEFB103A
Synonyms : DEFB103A; defensin, beta 103A; DEFB3, DEFB103, defensin, beta 3; beta-defensin 103; DEFB 3; HBD 3; HBD3; HBP 3; HBP3; beta-defensin 3; defensin, beta 3; defensin, beta 103; defensin-like protein; BD-3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103;
Gene ID : 414325
mRNA Refseq : NM_001081551
Protein Refseq : NP_001075020
MIM : 606611
UniProt ID : P81534

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
What specific clinical conditions are associated with DEFB103A deficiency? 02/14/2023

DEFB103A deficiency has been linked to an increased susceptibility to various infections, particularly those affecting the skin and mucosal surfaces.

Are there any side effects or concerns associated with the therapeutic use of DEFB103A? 11/22/2021

While research is ongoing, potential side effects and concerns related to the therapeutic use of DEFB103A or its analogs need to be thoroughly investigated, including any possible immunogenicity.

How does DEFB103A interact with the human microbiome? 02/13/2019

DEFB103A plays a role in maintaining a balanced microbiome by exerting selective antimicrobial activity. Understanding this interaction is crucial for potential applications in microbiome-related disorders.

In what ways does DEFB103A play a role in inflammatory diseases? 07/05/2017

DEFB103A is implicated in modulating inflammation. It can influence the immune response and may have a role in inflammatory conditions such as psoriasis and inflammatory bowel disease.

How does DEFB103A contribute to the immune system? 02/27/2017

DEFB103A plays a crucial role in the innate immune system by acting as an antimicrobial peptide. It helps defend the body against a wide range of pathogens, including bacteria, viruses, and fungi.

Customer Reviews (3)

Write a review
Reviews
10/11/2022

    This unique capability to selectively bind to exposed PS simplifies the identification and quantification of different cellular populations, reducing experimental errors and enhancing accuracy.

    06/23/2018

      They can provide technical assistance, ensuring optimal utilization of the product.

      10/28/2017

        This may include providing detailed protocols, troubleshooting guidance, and access to knowledgeable experts who can answer any inquiries or concerns.

        Ask a Question for All DEFB103A Products

        Required fields are marked with *

        My Review for All DEFB103A Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends