Recombinant Human DEFB103A Protein

• Cat.No.: DEFB103A-69H
• Product Overview: Recombinant Human DEFB103A Protein without tag was expressed in E. coli.

Specification

• Description: Beta-Defensin 3 (BD-3), also known as DEFB-3, is a member of the defensin class of antimicrobial peptides. Beta defensins exert host defense responses against viruses, bacteria, and fungi through the binding and permeabilizing of microbial membranes. BD-3 expression is stimulated by interferon-gamma and is an important molecule during adaptive immunity. BD-3 functions to activate monocytes and mast cells, and has antibacterial functions towards Gram-negative and Gram-positive bacteria. Further, BD-3 blocks human immunodeficiency virus type 1 (HIV-1) replication through the downregulation of the HIV-1 co-receptor, CXCR4.
• Source: E. coli
• Species: Human
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Monomer, 5.2 kDa (45 aa)
• AA Sequence: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile 10 mM acetic acid at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: DEFB103A defensin, beta 103A [ Homo sapiens (human) ]
• Official Symbol: DEFB103A
• Synonyms: DEFB103A; defensin, beta 103A; DEFB3, DEFB103, defensin, beta 3; beta-defensin 103; DEFB 3; HBD 3; HBD3; HBP 3; HBP3; beta-defensin 3; defensin, beta 3; defensin, beta 103; defensin-like protein; BD-3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103
• Gene ID: 414325
• mRNA Refseq: NM_001081551
• Protein Refseq: NP_001075020
• UniProt ID: P81534

Reviews

10/11/2022

This unique capability to selectively bind to exposed PS simplifies the identification and quantification of different cellular populations, reducing experimental errors and enhancing accuracy.

06/23/2018

They can provide technical assistance, ensuring optimal utilization of the product.

10/28/2017

This may include providing detailed protocols, troubleshooting guidance, and access to knowledgeable experts who can answer any inquiries or concerns.

Q&As

What specific clinical conditions are associated with DEFB103A deficiency?

DEFB103A deficiency has been linked to an increased susceptibility to various infections, particularly those affecting the skin and mucosal surfaces.

Are there any side effects or concerns associated with the therapeutic use of DEFB103A?

While research is ongoing, potential side effects and concerns related to the therapeutic use of DEFB103A or its analogs need to be thoroughly investigated, including any possible immunogenicity.

How does DEFB103A interact with the human microbiome?

DEFB103A plays a role in maintaining a balanced microbiome by exerting selective antimicrobial activity. Understanding this interaction is crucial for potential applications in microbiome-related disorders.

In what ways does DEFB103A play a role in inflammatory diseases?

DEFB103A is implicated in modulating inflammation. It can influence the immune response and may have a role in inflammatory conditions such as psoriasis and inflammatory bowel disease.

How does DEFB103A contribute to the immune system?

DEFB103A plays a crucial role in the innate immune system by acting as an antimicrobial peptide. It helps defend the body against a wide range of pathogens, including bacteria, viruses, and fungi.