Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DEFB103A protein, GST-tagged

Cat.No. : DEFB103A-301628H
Product Overview : Recombinant Human DEFB103A (23-67 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length : Met23-Lys67
AA Sequence : MGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name : DEFB103A defensin, beta 103A [ Homo sapiens ]
Official Symbol : DEFB103A
Synonyms : DEFB103A; defensin, beta 103A; DEFB3, DEFB103, defensin, beta 3; beta-defensin 103; DEFB 3; HBD 3; HBD3; HBP 3; HBP3; beta-defensin 3; defensin, beta 3; defensin, beta 103; defensin-like protein; BD-3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103;
Gene ID : 414325
mRNA Refseq : NM_001081551
Protein Refseq : NP_001075020
UniProt ID : P81534

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
What specific clinical conditions are associated with DEFB103A deficiency? 02/14/2023

DEFB103A deficiency has been linked to an increased susceptibility to various infections, particularly those affecting the skin and mucosal surfaces.

Are there any side effects or concerns associated with the therapeutic use of DEFB103A? 11/22/2021

While research is ongoing, potential side effects and concerns related to the therapeutic use of DEFB103A or its analogs need to be thoroughly investigated, including any possible immunogenicity.

How does DEFB103A interact with the human microbiome? 02/13/2019

DEFB103A plays a role in maintaining a balanced microbiome by exerting selective antimicrobial activity. Understanding this interaction is crucial for potential applications in microbiome-related disorders.

In what ways does DEFB103A play a role in inflammatory diseases? 07/05/2017

DEFB103A is implicated in modulating inflammation. It can influence the immune response and may have a role in inflammatory conditions such as psoriasis and inflammatory bowel disease.

How does DEFB103A contribute to the immune system? 02/27/2017

DEFB103A plays a crucial role in the innate immune system by acting as an antimicrobial peptide. It helps defend the body against a wide range of pathogens, including bacteria, viruses, and fungi.

Customer Reviews (3)

Write a review
Reviews
10/11/2022

    This unique capability to selectively bind to exposed PS simplifies the identification and quantification of different cellular populations, reducing experimental errors and enhancing accuracy.

    06/23/2018

      They can provide technical assistance, ensuring optimal utilization of the product.

      10/28/2017

        This may include providing detailed protocols, troubleshooting guidance, and access to knowledgeable experts who can answer any inquiries or concerns.

        Ask a Question for All DEFB103A Products

        Required fields are marked with *

        My Review for All DEFB103A Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends