Recombinant Human DNMT3A, His-tagged
Cat.No. : | DNMT3A-26885TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 269-546 (278 amino acids) of Human Dnmt3a (Isoform b) with N terminal His tag; MWt 32kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Highly expressed in fetal tissues, skeletal muscle, heart, peripheral blood mononuclear cells, kidney, and at lower levels in placenta, brain, liver, colon, spleen, small intestine and lung. |
Form : | Lyophilised:Reconstitute with 136 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISC GSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQS YCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQ AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFAN NHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLK DLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRS VTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGT GRLFFEFY |
Sequence Similarities : | Belongs to the C5-methyltransferase family.Contains 1 ADD domain.Contains 1 GATA-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain. |
Gene Name : | DNMT3A DNA (cytosine-5-)-methyltransferase 3 alpha [ Homo sapiens ] |
Official Symbol : | DNMT3A |
Synonyms : | DNMT3A; DNA (cytosine-5-)-methyltransferase 3 alpha; DNA (cytosine-5)-methyltransferase 3A; |
Gene ID : | 1788 |
mRNA Refseq : | NM_022552 |
Protein Refseq : | NP_072046 |
MIM : | 602769 |
Uniprot ID : | Q9Y6K1 |
Chromosome Location : | 2p23 |
Pathway : | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Methionine degradation, organism-specific biosystem; Methionine degradation, conserved biosystem; |
Function : | DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; DNA binding; chromatin binding; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
DNMT3A-2473M | Recombinant Mouse DNMT3A Protein, His (Fc)-Avi-tagged | +Inquiry |
Dnmt3a-2621M | Recombinant Mouse Dnmt3a Protein, Myc/DDK-tagged | +Inquiry |
DNMT3A-01H | Recombinant Human DNMT3A Protein, GST/StrepII-tagged | +Inquiry |
DNMT3A-2790H | Recombinant Human DNMT3A Protein, GST-tagged | +Inquiry |
DNMT3A-1585R | Recombinant Rat DNMT3A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
DNMT3A-6855HCL | Recombinant Human DNMT3A 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionDNMT3A mutations can serve as biomarkers for certain cancers, aiding in the diagnosis and classification of hematologic malignancies.
DNMT3A is essential for normal DNA methylation patterns during development and differentiation, influencing gene expression and cellular function.
Like many targeted therapies, DNMT3A-targeted treatments may have off-target effects, and their specificity is an area of active research.
Yes, molecular diagnostic tests, such as DNA sequencing, can identify DNMT3A mutations in cancer cells.
DNMT3A mutations lead to abnormal DNA methylation patterns, contributing to altered gene expression and promoting cancer development.
Customer Reviews (3)
Write a reviewIts exceptional characteristics, coupled with the manufacturer's commitment to customer satisfaction, ensure that I can pursue my scientific investigations with confidence and success.
Its consistent performance and reproducibility have been praised by scientists who have employed it in their studies, with many reporting outstanding results and a high level of satisfaction.
This level of support becomes invaluable, allowing researchers to focus on their scientific objectives while receiving expert guidance alongside.
Ask a Question for All DNMT3A Products
Required fields are marked with *
My Review for All DNMT3A Products
Required fields are marked with *
Inquiry Basket