Recombinant Human RPA1, His-tagged

• Cat.No.: RPA1-31145TH
• Product Overview: Recombinant fragment, corresponding to amino acids 257-616 of Human RPA70 with N terminal His tag; Predicted MWt 42 kDa.

Specification

• Description: Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 78 μl distilled water.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLP TVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITV RSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSR QPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYK LRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKS ENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNK KVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQEN QWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQN ANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGR RLVMSIRRSALM

Gene Information

• Gene Name: RPA1 replication protein A1, 70kDa [ Homo sapiens ]
• Official Symbol: RPA1
• Synonyms: RPA1; replication protein A1, 70kDa; replication protein A1 (70kD); replication protein A 70 kDa DNA-binding subunit; HSSB; REPA1; RF A; RP A; RPA70
• Gene ID: 6117
• mRNA Refseq: NM_002945
• Protein Refseq: NP_002936
• MIM: 179835
• Uniprot ID: P27694
• Chromosome Location: 17p13.3
• Pathway: Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the RAD51-ssDNA nucleoprotein complex, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem
• Function: DNA binding; metal ion binding; protein binding; single-stranded DNA binding

Reviews

04/20/2021

The background of RPA1 in Western blot was very clean and showed good antibody specificity.

02/09/2019

Beacuse reproducibility of RPA1 was very good and consistent results were obtained in each experiment, which gave me more confidence in the experimental results.

01/27/2019

RPA1 have a wide range of applications and can be used in various biological experiments.

Q&As

What is the importance of RPA1 protein in DNA recombination?

RPA1 protein is involved in important steps such as pairing, redox, and fusion in DNA recombination, and is necessary to effectively maintain genome integrity and stability.

What is the role of RPA1 protein in embryonic development?

RPA1 protein participates in DNA damage repair, growth and development in embryonic development, and has a role in maintaining the genome in embryos.

Can RPA1 protein be used to monitor or detect oxidative damage to DNA?

Since RPA1 protein plays an important role in DNA oxidative damage repair, it can be used as a marker of the degree of DNA oxidative damage to monitor and detect the risk of related diseases.

Is the RPA1 protein involved in DNA methylation modifications?

Although RPA1 protein is not a factor directly involved in DNA methylation modification, it may be involved in DNA methylation by participating in processes such as DNA damage repair, chromatin structure, and regulation of gene expression.

What role does RPA1 play in diabetes?

Studies have shown that RPA1 protein is involved in processes such as insulin secretion and regulation of β cell function in diabetes, and may become a new target for therapeutic strategies.

Is RPA1 protein involved in the immune system?

The RPA1 protein is involved in DNA damage repair and cell cycle in the immune system, and studies have found that it may be involved in processes such as immune response and pattern recognition.