Recombinant Human SUMF1, His-tagged

• Cat.No.: SUMF1-30918TH
• Product Overview: Recombinant fragment of Human SUMF1 with an N terminal His tag; 304aa, 34.1kDa.

Specification

• Description: This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.
• Protein length: 284 amino acids
• Conjugation: HIS
• Molecular Weight: 34.100kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Ubiquitous. Highly expressed in kidney, pancreas and liver. Detected at lower levels in leukocytes, lung, placenta, small intestine, skeletal muscle and heart.
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.03% DTT, 12.01% Urea
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMVPIPAGVFTMGTDDPQIKQ DGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAE KFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRH PEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAE WEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNT GEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHH SVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARS QNTPDSSASNLGFRCAADRLPTMD
• Sequence Similarities: Belongs to the sulfatase-modifying factor family.

Gene Information

• Gene Name: SUMF1 sulfatase modifying factor 1 [ Homo sapiens ]
• Official Symbol: SUMF1
• Synonyms: SUMF1; sulfatase modifying factor 1; sulfatase-modifying factor 1; FGE; UNQ3037
• Gene ID: 285362
• mRNA Refseq: NM_182760
• Protein Refseq: NP_877437
• MIM: 607939
• Uniprot ID: Q8NBK3
• Chromosome Location: 3p26.1
• Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem
• Function: binding; metal ion binding; oxidoreductase activity; protein homodimerization activity

Reviews

02/10/2022

Expert protein engineering support, an invaluable resource for our project.

06/14/2019

Consistent western blot results, a lab necessity for our research.

05/17/2019

Great protein crystallization service, vital for our structural biology work.

Q&As

What is the impact of SUMF1 on lysosomal function and storage diseases?

SUMF1 plays a role in lysosomal function, with implications for lysosomal storage diseases.

How does SUMF1 influence bone development and skeletal disorders?

SUMF1 influences bone growth and development, potentially affecting skeletal health and disorders.

What role does SUMF1 play in the degradation of glycosaminoglycans and mucopolysaccharides?

SUMF1 aids in the degradation of glycosaminoglycans, crucial for the breakdown of these complex molecules.

What are the mechanisms by which SUMF1 modulates cellular detoxification processes?

SUMF1 contributes to cellular detoxification, aiding in the breakdown of potentially harmful substances.

How do alterations in SUMF1 expression or function affect neurological development and function?

Variations in SUMF1 activity can impact neurological development and function, influencing brain health and disease.

How does SUMF1 deficiency contribute to the development of multiple sulfatase deficiency (MSD) and related symptoms?

SUMF1 deficiency leads to multiple sulfatase deficiency, disrupting normal metabolism and causing various symptoms.

How does SUMF1 (Sulfatase Modifying Factor 1) activate sulfatase enzymes involved in cellular metabolism?

SUMF1 is essential for the activation of sulfatase enzymes, impacting their role in cellular metabolism.