Active Recombinant Human DEFB103A Protein
Cat.No. : | DEFB103A-541H |
Product Overview : | Recombinant Human DEFB103A Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Defensins (alpha and beta) are cationic peptides with antimicrobial activity against Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses. They are 2-6 kDa proteins and take important roles in innate immune system. On the basis of their size and pattern of disulfide bonding, mammalian defensins are classified into alpha, beta and theta categories. β-Defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. Four human β-defensins have been identified and they are expressed on some leukocytes and at epithelial surfaces. Because β-defensins is cationic peptides, they can therefore interact with the membrane of invading microbes, which are negative due to lipopolysaccharides (LPS) and lipoteichoic acid (LTA) found in the cell membrane. Especially, they have higher affinity to the binding site compared to Ca2+ and Mg2+ ions. Furthermore, they can affect the stability of the membrane. |
Source : | E. coli |
Species : | Human |
Tag : | Tag Free |
Form : | Sterile Filtered White lyophil |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by anti-microbial activity against E. coli. is less than 30 μg/mL, corresponding to a specific activity of > 33.3 IU/mg. |
Molecular Mass : | Approximately 5.2 kDa |
AA Sequence : | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
Endotoxin : | Less than 1 EU/μg of rHuBD-3 as determined by LAL method. |
Purity : | > 98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. |
Gene Name : | DEFB103A defensin, beta 103A [ Homo sapiens (human) ] |
Official Symbol : | DEFB103A |
Synonyms : | DEFB103A; defensin, beta 103A; DEFB3, DEFB103, defensin, beta 3; beta-defensin 103; DEFB 3; HBD 3; HBD3; HBP 3; HBP3; beta-defensin 3; defensin, beta 3; defensin, beta 103; defensin-like protein; BD-3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103; |
Gene ID : | 414325 |
mRNA Refseq : | NM_001081551 |
Protein Refseq : | NP_001075020 |
UniProt ID : | P81534 |
Products Types
◆ Recombinant Protein | ||
DEFB103A-69H | Recombinant Human DEFB103A Protein | +Inquiry |
DEFB103A-2522H | Recombinant Human DEFB103A Protein, GST-tagged | +Inquiry |
DEFB103A-84H | Recombinant Human DEFB103A protein | +Inquiry |
DEFB103A-85H | Recombinant Human DEFB103A protein, His-tagged | +Inquiry |
DEFB103A-301628H | Recombinant Human DEFB103A protein, GST-tagged | +Inquiry |
◆ Lysates | ||
DEFB103A-464HCL | Recombinant Human DEFB103A cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionDEFB103A deficiency has been linked to an increased susceptibility to various infections, particularly those affecting the skin and mucosal surfaces.
While research is ongoing, potential side effects and concerns related to the therapeutic use of DEFB103A or its analogs need to be thoroughly investigated, including any possible immunogenicity.
DEFB103A plays a role in maintaining a balanced microbiome by exerting selective antimicrobial activity. Understanding this interaction is crucial for potential applications in microbiome-related disorders.
DEFB103A is implicated in modulating inflammation. It can influence the immune response and may have a role in inflammatory conditions such as psoriasis and inflammatory bowel disease.
DEFB103A plays a crucial role in the innate immune system by acting as an antimicrobial peptide. It helps defend the body against a wide range of pathogens, including bacteria, viruses, and fungi.
Customer Reviews (3)
Write a reviewThis unique capability to selectively bind to exposed PS simplifies the identification and quantification of different cellular populations, reducing experimental errors and enhancing accuracy.
They can provide technical assistance, ensuring optimal utilization of the product.
This may include providing detailed protocols, troubleshooting guidance, and access to knowledgeable experts who can answer any inquiries or concerns.
Ask a Question for All DEFB103A Products
Required fields are marked with *
My Review for All DEFB103A Products
Required fields are marked with *
Inquiry Basket