Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ALG5, His-tagged

Cat.No. : ALG5-25H
Product Overview : Recombinant Human Asparagine-Linked Glycosylation Protein 5 Homolog/ALG5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Asp324) of Human ALG5 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Asparagine-Linked Glycosylation Protein 5 Homolog (ALG5) belongs to the glycosyltransferase 2 family. ALG5 is a single-pass type II membrane protein and is found in the Endoplasmic Reticulum membrane. It is also expressed in the pancreas, placenta, kidney, skeletal muscle, liver, heart, brain, and lung. ALG5 participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition.
Source : HEK293
Species : Human
Tag : His
AA Sequence : TTATKMPALHRHEEEKFFLNAKGQKETLPSIW DSPTKQLSVVVPSYNEEKRLPVMMDEALSYLE KRQKRDPAFTYEVIVVDDGSKDQTSKVA FKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRG EKILMADADGATKFPDVEKLEKGL NDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFH FLVWFLCVKGIRDTQCGFKL FTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTE IEGSKLVPFWSWLQMG KDLLFIRLRYLTGAWRLEQTRKMN
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name : ALG5 asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol : ALG5
Synonyms : ALG5; asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 5 homolog (yeast, dolichyl phosphate beta glucosyltransferase); dolichyl-phosphate beta-glucosyltransferase; bA421P11.2; dolP-glucosyltransferase; Alg5, S. cerevisiae, homolog of; dolichyl phosphate glucosyltransferase; asparagine-linked glycosylation protein 5 homolog; asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase); asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphate beta-glucosyltransferase); RP11-421P11.2;
Gene ID : 29880
mRNA Refseq : NM_001142364
Protein Refseq : NP_001135836
MIM : 604565
UniProt ID : Q9Y673
Chromosome Location : 13q13.1
Pathway : Asparagine N-linked glycosylation, organism-specific biosystem; Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem; Post-translational protein modification, organism-specific biosystem;
Function : dolichyl-phosphate beta-glucosyltransferase activity; oligosaccharyl transferase activity; transferase activity, transferring glycosyl groups;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (17)

Ask a question
Which metabolic pathways are involved in ALG5? 12/26/2022

It is involved in metabolic pathways such as glycosylation and glucose metabolism.

How is ALG5 distributed in mammalian cells? 11/27/2022

It is mainly distributed in the endoplasmic reticulum and Golgi apparatus in mammalian cells.

What effect does overexpression or knockout of ALG5 have on cells? 10/11/2022

Overexpression or knockout of ALG5 can negatively affect the glycosylation of cells and the stability of ER and Golgi bodies, but the specific effects need to be further explored.

What are the molecular biological characteristics of ALG5? 08/23/2022

ALG5 plays an important role in protein glycosylation, participating in the synthesis and modification of sugar chains.

What are the interacting proteins of ALG5? 05/13/2022

ALG5 interacts with members of the glycosylase family such as ALG3, ALG2 and other related proteins to jointly regulate the glycosylation process of proteins.

What non-cellular autophagy pathways are involved in ALG5? 03/28/2022

Although there are currently no studies demonstrating the function of ALG5 in non-cellular autophagy pathways, there are indications that it may be involved in the TCA cycle and gluconeogenic pathways.

What biological processes does ALG5 participate in? 01/03/2022

ALG5 is involved in several biological processes including protein glycosylation, ER and Golgi body sugar metabolism.

What is the gene structure and regulation of ALG5? 12/29/2021

The ALG5 gene contains 9 exons and its expression is influenced by multiple regulatory elements and signaling pathways.

What are the effects of ALG5 inhibitors? 10/11/2021

A number of inhibitors have been developed that target ALG5 and inhibit its glycosylation activity, thereby interfering with its function in cellular processes.

In what metabolic diseases does ALG5 play a role? 08/03/2021

ALG5 mutation may lead to the occurrence and development of some metabolic diseases such as CDG, and further investigation is needed to confirm its role in metabolic diseases.

In which cancers does ALG5 play a role? 04/22/2021

At present, there is no direct evidence that ALG5 is related to the occurrence and development of cancer, but glycosylation plays an important role in metabolism and disease development, so it may be relevant to related diseases.

Does ALG5 participate in mitochondrial glucose metabolism? 01/15/2021

No studies have confirmed whether ALG5 is involved in mitochondrial glucose metabolism, and more studies are needed to prove it.

Does ALG5 mutation have an adverse effect on embryonic development? 10/31/2020

The mutations can have adverse effects on embryonic development and may therefore be associated with a number of fetal diseases.

Which cell signaling molecules are involved in ALG5? 07/18/2020

The regulates the expression of glycosylase and the balance of glycosylation reaction by interacting with other glycosylated enzymes such as ALG3 and ALG2.

Which diseases do ALG5 mutations cause? 05/19/2020

This protein mutation may be associated with some genetic diseases, such as CDG (Congenital Disorder of Glycosylation).

In what neurological diseases does ALG5 play a role? 04/08/2020

ALG5 plays an important role in some neurological diseases, such as central nervous system dysplasia, leading to symptoms such as mental retardation.

What is the sugar chain selectivity of ALG5? 08/19/2019

ALG5 selectively catalyzes the synthesis and modification of sugar chains and plays an important role in the binding selectivity of glycosylase family members to substrate proteins.

Customer Reviews (4)

Write a review
Reviews
01/30/2023

    ALG5 has been found to induce specific immune responses in immunotherapy, which has potential value for disease treatment.

    09/27/2022

      ALG5 was found to efficiently load and release drugs in drug delivery systems.

      07/23/2022

        In vaccine studies, ALG5 has been found to induce immunoprotective effects and has potential for disease prevention.

        08/27/2020

          In genetic engineering studies, ALG5 has been found to have good application potential in protein engineering and recombinant expression.

          Ask a Question for All ALG5 Products

          Required fields are marked with *

          My Review for All ALG5 Products

          Required fields are marked with *

          0

          Inquiry Basket

          cartIcon
          logo

          FOLLOW US

          Terms and Conditions        Privacy Policy

          Copyright © 2024 Creative BioMart. All Rights Reserved.

          Contact Us

          • /

          Stay Updated on the Latest Bioscience Trends