Recombinant Human ASAP1 protein, GST-tagged

• Cat.No.: ASAP1-881H
• Product Overview: Human ASAP1 full-length ORF ( ADR82673.1, 1 a.a. - 36 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an ADP-ribosylation factor (ARF) GTPase-activating protein. The GTPase-activating activity is stimulated by phosphatidylinositol 4,5-biphosphate (PIP2), and is greater towards ARF1 and ARF5, and lesser for ARF6. This gene maybe involved in regulation of membrane trafficking and cytoskeleton remodeling. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 4 kDa
• AA Sequence: MNAHLSDVLKHPLHPFFIIFLVLFLDKFKLLKDYSR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ASAP1 ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 [ Homo sapiens ]
• Official Symbol: ASAP1
• Synonyms: ASAP1; ArfGAP with SH3 domain, ankyrin repeat and PH domain 1; DDEF1, development and differentiation enhancing factor 1; arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1; centaurin; beta 4; CENTB4; KIAA1249; PAP; ZG14P; DEF-1; centaurin, beta 4; PIP2-dependent ARF1 GAP; ARF GTPase-activating protein 1; development and differentiation-enhancing factor 1; ADP-ribosylation factor-directed GTPase-activating protein 1; 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein; 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein; PAG2; AMAP1; DDEF1
• Gene ID: 50807
• mRNA Refseq: NM_001247996
• Protein Refseq: NP_001234925
• MIM: 605953
• UniProt ID: Q9ULH1

Reviews

12/25/2020

I have found the ASAP1 Protein to be highly stable, enabling long-term experiments without compromising its performance.

05/08/2019

One aspect that sets the ASAP1 Protein apart is the excellent technical support provided by the manufacturer.

01/09/2016

The ASAP1 Protein is an exceptional product that fully meets my experimental needs.

Q&As

How does ASAP1 participate in actin cytoskeleton remodeling?

ASAP1 binds to actin-binding proteins and actin regulatory proteins, enabling it to regulate actin dynamics and cytoskeleton rearrangements in response to cellular signaling.

What cellular processes are regulated by ASAP1's Arf-GAP activity?

ASAP1's Arf-GAP activity influences processes such as endocytosis, exocytosis, membrane recycling, and protein trafficking.

Is ASAP1 expression altered in cancer?

Yes, ASAP1 expression levels can be dysregulated in certain cancer types, leading to increased invasiveness and poor prognosis.

Does ASAP1 play a role in cancer development or progression?

Yes, ASAP1 has been implicated in cancer progression, promoting cell migration, invasion, and metastasis.

Where is ASAP1 primarily localized within cells?

ASAP1 is found predominantly at the plasma membrane, where it participates in various cellular activities.

What other proteins interact with ASAP1?

ASAP1 interacts with various proteins, including members of the Arf family, components of the endocytic machinery, regulators of actin dynamics, and other signal transduction molecules.

Are there any mutations or genetic variations associated with ASAP1?

Mutations or genetic variations in ASAP1 have not been extensively reported, but further research is required to explore their potential associations.