Recombinant Human TAF1 protein (Tagged)


  • Specification
  • Related Products
Cat.No.:  PE-2129
Product Name:  Recombinant Human TAF1 protein (Tagged)
Background:  TAF1 functions as a component of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. Compared to higher eukaryotes TAF1, yeast TAF1 lacks the C-terminal bromodomains and C-terminal kinase activity. The TFIID interacting proteins BDF1 and BDF2 may substitute for these domains.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  42 kDa including tags
Purity:  > 95 % SDS-PAGE.
Species:  Human
Accession#:  P21675
Alternative Names:  BA2R/CCG 1/CCG1
Amino Acid Sequence:  HKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKI ITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQIS QSMLDLCDEKLKEKEDKLAR LEKAIN
Expression System:  E. coli
Protein Length:  Protein fragment; 1371 to 1496
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.