Cat.No.: | PE-2152 |
Product Name: | Recombinant Human BCOR protein |
Background: | Transcriptional corepressor. May specifically inhibit gene expression when recruited to promoter regions by sequence specific DNA-binding proteins such as BCL6 and MLLT3. This repression may be mediated at least in part by histone deacetylase activities which can associate with this corepressor. Involved in the repression of TFAP2A; impairs binding of BCL6 and KDM2B to TFAP2A promoter regions. Via repression of TFAP2A acts as a negative regulator of osteo-dentiogenic capacity in adult stem cells; the function implies inhibition of methylation on histone H3 'Lys-4' (H3K4me3) and 'Lys-36' (H3K36me2). |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | 5830466J11Rik/8430401K06Rik/ANOP 2 |
Tag: | GST |
Amino Acid Sequence: | RRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETT QSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRD |
Sequence Similarities: | Belongs to the BCOR family.Contains 3 ANK repeats. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 1361 to 1460 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0087 | Recombinant Human BCOR 293 Cell Lysate | Inquiry |
◆ Proteins & Enzymes | ||
PE-0708 | Recombinant Human BCOR, GST-tagged | Inquiry |
PE-0709 | Recombinant Zebrafish BCOR | Inquiry |
PE-0710 | Recombinant Mouse BCOR Protein | Inquiry |
PE-0711 | Recombinant Human BCOR Protein, GST-tagged | Inquiry |
Related Gene / Proteins | |||
Bcl10 | BCL11A | Bcl3 | Bcl6 |
BCOR |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools