Recombinant Human KAT3A / CBP protein (His tag)


  • Specification
  • Related Products
Cat.No.:  PE-2185
Product Name:  Recombinant Human KAT3A / CBP protein (His tag)
Background:  Acetylates histones, giving a specific tag for transcriptional activation. Also acetylates non-histone proteins, like NCOA3 coactivator. Binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes. Acts as a coactivator of ALX1 in the presence of EP300.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  15 kDa including tags
Purity:  > 98 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8.0; Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol
Accession#:  Q92793
Alternative Names:  CBP/CBP_HUMAN/CREB binding protein
Tag:  His
Amino Acid Sequence:  RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVK NPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSK LAEVFEQEIDPVMQSLG
Sequence Similarities:  Contains 1 bromo domain.Contains 1 KIX domain.Contains 2 TAZ-type zinc fingers.Contains 1 ZZ-type zinc finger.
Expression System:  E. coli
Post Translational Modifications:  Methylation of the KIX domain by CARM1 blocks association with CREB. This results in the blockade of CREB signaling, and in activation of apoptotic response.Phosphorylated upon DNA damage, probably by ATM or ATR.Sumoylation negatively regulates transcriptional activity via the recruitment of DAAX.
Protein Length:  Protein fragment; 1081 to 1197
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Cell Lines
CL-0055 Human CREBBP Knockout Cell Line 1bp insertion Inquiry
◆ Bioactive Small Molecules
BSM-0094 C646 Inquiry
BSM-0124 EML-425 Inquiry
BSM-0150 I-CBP112 (Hydrochloride) Inquiry
◆ Research Kits
EKIT-0122 CBP bromodomain TR-FRET Assay Kit Inquiry
Related Gene / Proteins
CREB CREB3 crebbp CRISP1
CRISP3 CRP

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.