Recombinant Human JMJD6 protein (Tagged)


  • Specification
  • Related Products
Cat.No.:  PE-2199
Product Name:  Recombinant Human JMJD6 protein (Tagged)
Background:  Dioxygenase that can both act as a histone arginine demethylase and a lysyl-hydroxylase. Acts as a lysyl-hydroxylase that catalyzes 5-hydroxylation on specific lysine residues of target proteins such as U2AF2/U2AF65 and LUC7L2. Acts as a regulator of RNA splicing by mediating 5-hydroxylation of U2AF2/U2AF65, affecting the pre-mRNA splicing activity of U2AF2/U2AF65. In addition to peptidyl-lysine 5-dioxygenase activity, may act as a RNA hydroxylase, as suggested by its ability to bind single strand RNA. Also acts as an arginine demethylase which demethylates histone H3 at 'Arg-2' (H3R2me) and histone H4 at 'Arg-3' (H4R3me), thereby playing a role in histone code. However, histone arginine demethylation may not constitute the primary activity in vivo. Has no histone lysine demethylase activity. Required for differentiation of multiple organs during embryogenesis. Acts as a key regulator of hematopoietic differentiation: required for angiogenic sprouting by regulating the pre-mRNA splicing activity of U2AF2/U2AF65. Seems to be necessary for the regulation of macrophage cytokine responses.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  73 kDa including tags
Purity:  >50 % SDS-PAGE.
Species:  Human
Accession#:  Q6NYC1
Alternative Names:  Apoptotic cell clearance receptor/Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6/Histone arginine demethylase JMJD6
Amino Acid Sequence:  NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADA LQLSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKC GEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYK VPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQ GHKRWCLFPTSTPRELIKVTRDEGGNQQDEAITWFNVIY PRTQLPTWP PEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWH KTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSS SSSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKER SSSR
Sequence Similarities:  Belongs to the JMJD6 family.Contains 1 JmjC domain.
Expression System:  E. coli
Protein Length:  Protein fragment; 2 to 403
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.