Recombinant Human CoREST protein


  • Specification
  • Related Products
Cat.No.:  PE-2206
Product Name:  Recombinant Human CoREST protein
Background:  Essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it serves as a molecular beacon for the recruitment of molecular machinery, including MeCP2 and SUV39H1, that imposes silencing across a chromosomal interval. Plays a central role in demethylation of Lys-4 of histone H3 by promoting demethylase activity of KDM1A on core histones and nucleosomal substrates. It also protects KDM1A from the proteasome.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  20 kDa including tags
Purity:  >80 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8.5; Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol
Accession#:  Q9UKL0
Alternative Names:  COREST/KIAA0071/Nr2b2
Tag:  His
Amino Acid Sequence:  RAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQ TNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQA ISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKP VKSPDNSIKMPEEEDEAPVLDVRYASAS
Sequence Similarities:  Belongs to the CoREST family.Contains 1 ELM2 domain.Contains 2 SANT domains.
Expression System:  E. coli
Post Translational Modifications:  Phosphorylated by HSV-1 protein kinases in case of infection.
Protein Length:  Protein fragment; 305 to 482
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.