Recombinant human Ataxin 3 protein (Biotin)


  • Specification
  • Related Products
Cat.No.:  PE-2209
Product Name:  Recombinant human Ataxin 3 protein (Biotin)
Background:  Interacts with key regulators (CBP, p300 and PCAF) of transcription and represses transcription. Acts as a histone-binding protein that regulates transcription. Acts as a deubiquitinating enzyme.
Applications:  SDS-PAGE; Functional Studies
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  8 kDa
Purity:  > 95 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8.0; Constituents: 1.19% HEPES, 1.16% Sodium chloride, 0.02% DTT
Accession#:  P54252
Alternative Names:  AT3/Ataxin 3/ataxin 3 variant h
Amino Acid Sequence:  EDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSG TNLTSEELRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSS GALGSDLGKACSPFIMFATF TLYLT
Sequence Similarities:  Contains 1 Josephin domain.Contains 3 UIM (ubiquitin-interacting motif) repeats.
Expression System:  E. coli
Protein Length:  Protein fragment; 224 to 348
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.