Recombinant Human MRGX protein


  • Specification
  • Related Products
Cat.No.:  PE-2216
Product Name:  Recombinant Human MRGX protein
Background:  Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones.
Applications:  SDS-PAGE; Mass Spectrometry
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  34 kDa
Purity:  > 90 % SDS-PAGE.Purified using conventional chromatography.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol
Accession#:  Q15014
Alternative Names:  KIAA0026/MO4L2_HUMAN/MORF related gene X protein
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMSSRKQGSQPRGQQSAEEENFKKPTRSNMQ RSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQ KTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELK PWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVN EVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLR LFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVAS AEYHRKAL
Sequence Similarities:  Belongs to the MRG family.
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 288
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Antibodies
EAb-2092 MRG15 Polyclonal Antibody Inquiry
◆ Proteins & Enzymes
PE-2216 Recombinant Human MRGX protein Inquiry
PE-2217 Recombinant Human MRGX protein Inquiry
PE-2402 Recombinant Human MRG15 protein Inquiry
Related Gene / Proteins
MRG15 MRGX

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.