Cat.No.: | PE-2217 |
Product Name: | Recombinant Human MRGX protein |
Background: | Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones. |
Applications: | SDS-PAGE; HPLC |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Lyophilised |
Molecular Weight: | 33 kDa including tags |
Purity: | > 95 % as determined by SEC-HPLC and reducing SDS-PAGE. |
Species: | Human |
Formulation: | pH: 7.40; Constituents: 99% PBS, 0.88% Sodium chloride |
Accession#: | Q15014 |
Alternative Names: | KIAA0026/MO4L2_HUMAN/MORF related gene X protein |
Tag: | His |
Amino Acid Sequence: | MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKN LEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRK KRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLP AKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLY KFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLA LLLGYLHDFL KYLAKNSASLFTASDYKVASAEYHRKALLEHHHHHH |
Sequence Similarities: | Belongs to the MRG family. |
Expression System: | E. coli |
Protein Length: | Full length protein; 1 to 288 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-2092 | MRG15 Polyclonal Antibody | Inquiry |
◆ Proteins & Enzymes | ||
PE-2216 | Recombinant Human MRGX protein | Inquiry |
PE-2217 | Recombinant Human MRGX protein | Inquiry |
PE-2402 | Recombinant Human MRG15 protein | Inquiry |
Related Gene / Proteins | |||
MRG15 | MRGX |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools