Recombinant Human PRDM3 protein

Cat.No.:	PE-2274
Product Name:	Recombinant Human PRDM3 protein
Background:	PRDM3 can be produced either as a separate transcript and as a fusion transcript with EVI1. A chromosomal aberration involving PRDM3 is found in a form of acute myeloid leukemia. The myelodysplastic syndromes (MDS, formerly known as "preleukemia") are a diverse collection of hematological conditions united by ineffective production of blood cells and varying risks of transformation to acute myelogenous leukemia.
Applications:	ELISA; Western blot
Storage:	Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:	Liquid
Species:	Human
Formulation:	pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:	MDS1/MDS1 EVI1/MDS1EVI1
Tag:	GST
Amino Acid Sequence:	FELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLP RSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS
Expression System:	Wheat germ
Protein Length:	Protein fragment; 80 to 169
Warning:	This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Products