Recombinant Human NCOR2/SMRT protein


  • Specification
  • Related Products
Cat.No.:  PE-2289
Product Name:  Recombinant Human NCOR2/SMRT protein
Background:  Transcriptional corepressor of NR4A2/NURR1 and acts through histone deacetylases (HDACs) to keep promoters of NR4A2/NURR1 target genes in a repressed deacetylated state (By similarity). Mediates the transcriptional repression activity of some nuclear receptors by promoting chromatin condensation, thus preventing access of the basal transcription. Isoform 1 and isoform 5 have different affinities for different nuclear receptors.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  CTG 26/CTG repeat protein 26/CTG26
Tag:  GST
Amino Acid Sequence:  MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYA SHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEM EFIESKRPRL
Sequence Similarities:  Belongs to the N-CoR nuclear receptor corepressors family.Contains 2 SANT domains.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 1 to 110
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.