Cat.No.: | PE-2316 |
Product Name: | Recombinant Human Histone acetyltransferase MYST3/MOZ protein |
Background: | Histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May act as a transcriptional coactivator for RUNX1 and RUNX2. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | HAT 3/Histone acetyltransferase MYST3/Monocytic leukemia zinc finger protein |
Tag: | GST |
Amino Acid Sequence: | ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKD VSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK |
Sequence Similarities: | Belongs to the MYST (SAS/MOZ) family.Contains 1 C2HC-type zinc finger.Contains 1 H15 (linker histone H1/H5 globular) domain.Contains 2 PHD-type zinc fingers. |
Expression System: | Wheat germ |
Post Translational Modifications: | Autoacetylated.Phosphorylated upon DNA damage, probably by ATM or ATR. |
Protein Length: | Protein fragment; 81 to 179 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Synthetic Peptides | ||
SP-0174 | Human KAT8 / MYST1 / MOF peptide | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0174 | MOZ-IN-3 | Inquiry |
◆ Antibodies | ||
EAb-0184 | MYCBP Polyclonal Antibody | Inquiry |
EAb-0204 | c-Myb Polyclonal Antibody | Inquiry |
◆ Extracts & Lysates | ||
EL-0221 | Recombinant Human MORF4L2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
MOF | MORC2 | MORC3 | MORF |
MORF4L2 | MOZ | MYB | Myc |
MYCBP | Myf-5 | Myocilin | MyoD |
MYSM1 | MYST1 | MYST3 | Myt1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools