| Cat.No.: | PE-2326 |
| Product Name: | Recombinant Human SIRT3 protein |
| Background: | NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5O. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels. |
| Applications: | SDS-PAGE; Mass Spectrometry |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 34 kDa including tags |
| Purity: | > 95 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride |
| Accession#: | Q9NTG7 |
| Alternative Names: | hSIRT 3/hSIRT3/Mitochondrial nicotinamide adenine dinucleotide dependent deacetylase |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGA GISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFF HNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERV SGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGV VKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRS SVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDL VQRETGKLDGPDK |
| Sequence Similarities: | Belongs to the sirtuin family. Class I subfamily.Contains 1 deacetylase sirtuin-type domain. |
| Expression System: | E. coli |
| Post Translational Modifications: | Processed by mitochondrial processing peptidase (MPP) to give a 28 kDa product. Such processing is probably essential for its enzymatic activity. |
| Protein Length: | Protein fragment; 118 to 399 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
| EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
| EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
| SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
| Related Gene / Proteins | |||
| Siah2 | SIK1 | SIMC1 | SIN3A |
| SIN3B | SIP1 | Sir2p | SIRT |
| SIRT1 | SIRT2 | SIRT3 | SIRT4 |
| SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
