| Cat.No.: | PE-2335 |
| Product Name: | Recombinant Human KMT2D / MLL2 protein |
| Background: | Histone methyltransferase. Methylates 'Lys-4' of histone H3 (H3K4me). H3K4me represents a specific tag for epigenetic transcriptional activation. Plays a central role in beta-globin locus transcription regulation by being recruited by NFE2. Acts as a coactivator for estrogen receptor by being recruited by ESR1, thereby activating transcription. Plays an important role in controlling bulk H3K4me during oocyte growth and preimplantation development. Required during the transcriptionally active period of oocyte growth for the establishment and/or maintenance of bulk H3K4 trimethylation (H3K4me3), global transcriptional silencing that preceeds resumption of meiosis, oocyte survival and normal zygotic genome activation. |
| Applications: | ELISA; Western blot; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 37 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | O14686 |
| Alternative Names: | AAD10/ALL1 related gene/ALL1-related protein |
| Amino Acid Sequence: | SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGG SERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE |
| Sequence Similarities: | Belongs to the histone-lysine methyltransferase family. TRX/MLL subfamily.Contains 1 FY-rich C-terminal domain.Contains 1 FY-rich N-terminal domain.Contains 5 PHD-type zinc fingers.Contains 1 post-SET domain.Contains 4 RING-type zinc fingers.Contains 1 SET domain. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Protein Length: | Protein fragment; 1487 to 1586 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0170 | MI-3 | Inquiry |
| BSM-0187 | OICR-9429 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0172 | Human KMT2C / MLL3 peptide | Inquiry |
| ◆ Cell Lines | ||
| CL-0216 | Human KMT2A Knockout Cell Line 32bp deletion | Inquiry |
| ◆ Research Kits | ||
| EKIT-0285 | MLL1 Complex Chemiluminescent Assay Kit | Inquiry |
| Related Gene / Proteins | |||
| KMT1B | KMT1E | KMT2A | KMT2B |
| KMT2C | KMT2D | KMT2E | KMT3A |
| KMT3B | KMT3C | KMT5A | KMT6 |
| MLH1 | MLL | mll1 | MLL2 |
| MLL3 | MLL4 | MLL5 | MLLT1 More > |
| MLLT3 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools