Cat.No.: | PE-2411 |
Product Name: | Recombinant Human Jarid2 protein |
Background: | Regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis. Acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes. Binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells. Does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of 'Lys-27' of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of 'Lys-9' of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases. Also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5. Participates in the negative regulation of cell proliferation signaling. |
Applications: | SDS-PAGE; ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 37 kDa |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.31% Glutathione |
Accession#: | Q92833 |
Alternative Names: | JARD2/JARD2_HUMAN/JARID2 |
Tag: | GST |
Amino Acid Sequence: | LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLK LMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVP |
Sequence Similarities: | Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 1130 to 1229 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0002 | AT9283 | Inquiry |
◆ Cell Lines | ||
CL-0017 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
◆ Antibodies | ||
EAb-0079 | JARID2 Polyclonal Antibody | Inquiry |
EAb-0080 | JARID1C Polyclonal Antibody | Inquiry |
EAb-0081 | JARID1B Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
JADE1 | JAK | JAK1 | JAK2 |
JAK3 | JAKMIP1 | JARID | JARID1 |
JARID1A | JARID1B | JARID1C | JARID2 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools