| Cat.No.: | PE-2414 |
| Product Name: | Recombinant Human ING2 protein |
| Background: | Seems to be involved in p53/TP53 activation and p53/TP53-dependent apoptotic pathways, probably by enhancing acetylation of p53/TP53. Component of a mSin3A-like corepressor complex, which is probably involved in deacetylation of nucleosomal histones. ING2 activity seems to be modulated by binding to phosphoinositides (PtdInsPs). |
| Applications: | Western blot; ELISA; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 57 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.3% Glutathione |
| Accession#: | Q9H160 |
| Alternative Names: | ING 1 like tumor suppressor protein/ING 1L/ING 2 |
| Amino Acid Sequence: | MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLR ELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEK IQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSR RPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREA SPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPK GKWYCPKCRGDNEKTMGKSTEKTKKDRRSR |
| Sequence Similarities: | Belongs to the ING family.Contains 1 PHD-type zinc finger. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 280 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0182 | Recombinant Human ING5 293 Cell Lysate | Inquiry |
| EL-0189 | Recombinant Human ING3 293 Cell Lysate | Inquiry |
| EL-0196 | Recombinant Human ING4 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0317 | ING4 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0403 | Human INSL6 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| ING1 | ING2 | ING3 | ING4 |
| ING5 | INHAT-1 | INHAT-2 | Ini1 |
| INSL6 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
