| Cat.No.: | PE-2493 |
| Product Name: | Recombinant Human MAFF protein |
| Background: | Interacts with the upstream promoter region of the oxytocin receptor gene. May be a transcriptional enhancer in the up-regulation of the oxytocin receptor gene at parturition. Since it lacks a putative transactivation domain, it may behave as a transcriptional repressor when it dimerize among himself. May also serve as a transcriptional activator by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. May be involved in the cellular stress response. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Avian musculoaponeurotic fibrosarcoma virus (v maf) AS42 oncogene, protein F/CTA 447C4.1/hMafF |
| Tag: | GST |
| Amino Acid Sequence: | MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVT RLKQRRRTLKNRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAM RLELDALRGK |
| Sequence Similarities: | Belongs to the bZIP family. Maf subfamily.Contains 1 bZIP domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 1 to 110 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0025 | Human MAGI1 Knockout Cell Line | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0058 | Recombinant Human MAPK8 293 Cell Lysate | Inquiry |
| EL-0059 | Recombinant Human MAPK8 293 Cell Lysate | Inquiry |
| EL-0074 | Recombinant Human MAGEA2 293 Cell Lysate | Inquiry |
| EL-0096 | Recombinant Human MACROD2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| MACROD2 | MAF | MAFF | MAGEA2 |
| MAGI1 | MAGOH | MAK16 | MALT1 |
| MAPK8 | MASH1 | MASP1 | Mat2A |
| MATR3 | MAX | MAZ | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
