| Cat.No.: | PE-2510 |
| Product Name: | Recombinant Human HAGE protein |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Cancer/testis antigen 13/CT13/DDX43 |
| Tag: | GST |
| Amino Acid Sequence: | SHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRW RGTSRPPEAVAAGHEELPLCFALKSHFVGAVIGRGGSKI |
| Sequence Similarities: | Belongs to the DEAD box helicase family.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 1 KH domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 2 to 90 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0101 | HAT-3 Polyclonal Antibody | Inquiry |
| EAb-0102 | HAT-2 Polyclonal Antibody | Inquiry |
| ◆ Research Kits | ||
| EKIT-0142 | HAT (H4) Activity Fluorometric Assay Kit | Inquiry |
| EKIT-0143 | HAT Activity Colorimetric Assay Kit | Inquiry |
| EKIT-0144 | HAT Activity Fluorometric Assay Kit | Inquiry |
| Related Gene / Proteins | |||
| HAGE | Haspin | HAT | HAT1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
