| Cat.No.: | PE-2519 |
| Product Name: | Recombinant Human GATAD2A protein |
| Background: | Transcriptional repressor. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | FLJ20085/FLJ21017/GATA zinc finger domain containing 2A |
| Tag: | GST |
| Amino Acid Sequence: | QIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSV IPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPL LLAPRASVP |
| Sequence Similarities: | Contains 1 GATA-type zinc finger. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 26 to 134 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0023 | Human GATAD2B Knockout Cell Line | Inquiry |
| CL-0202 | Human GABRG2 Knockout Cell Line | Inquiry |
| CL-0468 | Human GATAD2B Knockout Cell Line | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0292 | Gemcitabine | Inquiry |
| BSM-0378 | Gemcitabine-13C,15N2 (hydrochloride) | Inquiry |
| Related Gene / Proteins | |||
| GABRG2 | Gadd45a | GAR | GASC1 |
| GATA-1 | GATA-4 | GATA-6 | GATAD2A |
| GATAD2B | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
