| Cat.No.: | PE-2585 |
| Product Name: | Recombinant Human CIRP protein |
| Background: | Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed. |
| Applications: | Mass Spectrometry; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 21 kDa including tags |
| Purity: | > 95 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.32% Tris HCl, 0.02% DTT, 50% Glycerol, 0.58% Sodium chloride |
| Accession#: | Q14011 |
| Alternative Names: | A18 hnRNP/A18HNRNP/cirbp |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMASDEGKLFVGGLSFDTNEQSLEQVFSKYG QISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD QAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFES RSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE |
| Sequence Similarities: | Contains 1 RRM (RNA recognition motif) domain. |
| Expression System: | E. coli |
| Post Translational Modifications: | Methylated on arginine residues. Methylation of the RGG motifs is a prerequisite for recruitment into SGs.Phosphorylated by CK2, GSK3A and GSK3B. Phosphorylation by GSK3B increases RNA-binding activity to the TXN 3'-UTR transcript upon exposure to UV radiation. |
| Protein Length: | Full length protein; 1 to 172 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0040 | Recombinant Human CITED2 Cell Lysate | Inquiry |
| EL-0114 | Recombinant Human CITED1 293 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0387 | Human CIB1 Knockout Cell Line | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0389 | Recombinant Human CITED2, His-tagged | Inquiry |
| PE-0390 | Recombinant Human CITED2, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| CIB1 | CIRP | CITED1 | CITED2 |
| CIZ1 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
