Cat.No.: | PE-2732 |
Product Name: | Recombinant Human ZNF346 protein |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | DKFZp547M223/Double stranded RNA binding zinc finger protein/Double stranded RNA binding zinc finger protein JAZ |
Tag: | GST |
Amino Acid Sequence: | NQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMID PDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTD |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 133 to 232 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-0169 | ZNF7 Polyclonal Antibody | Inquiry |
EAb-0170 | ZNF541 Polyclonal Antibody | Inquiry |
EAb-0171 | ZNF498 Polyclonal Antibody | Inquiry |
◆ Proteins & Enzymes | ||
PE-0432 | Recombinant Human ZNF295, His-tagged | Inquiry |
PE-0742 | Recombinant Zebrafish ZNF703 | Inquiry |
Related Gene / Proteins | |||
ZNF181 | ZNF295 | ZNF346 | ZNF498 |
ZNF541 | ZNF576 | ZNF692 | ZNF7 |
ZNF703 | ZNF74 | ZNF771 | ZNRF3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools