| Cat.No.: | PE-2735 |
| Product Name: | Recombinant Human ZNF576 protein |
| Background: | May be involved in transcriptional regulation. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | FLJ22700/MGC2508/Zinc finger protein 576 |
| Tag: | GST |
| Amino Acid Sequence: | MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQE RHMKREHPADFVAQKLQGVLFICFTCARSFPSSKALITHQRSHGPAAKPT LPVATTTAQPTFPCPDCGKTFGQAVSLRRHRQMHEVRAPPGTFACTECGQ DFAQEAGLHQHYIRHARGEL |
| Sequence Similarities: | Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 4 C2H2-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 170 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0169 | ZNF7 Polyclonal Antibody | Inquiry |
| EAb-0170 | ZNF541 Polyclonal Antibody | Inquiry |
| EAb-0171 | ZNF498 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0432 | Recombinant Human ZNF295, His-tagged | Inquiry |
| PE-0742 | Recombinant Zebrafish ZNF703 | Inquiry |
| Related Gene / Proteins | |||
| ZNF181 | ZNF295 | ZNF346 | ZNF498 |
| ZNF541 | ZNF576 | ZNF692 | ZNF7 |
| ZNF703 | ZNF74 | ZNF771 | ZNRF3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
