| Cat.No.: | PE-2782 |
| Product Name: | Recombinant Human RBMY1A1 protein |
| Background: | RNA-binding protein involved in pre-mRNA splicing. Required for sperm development. Acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN. Binds non-specifically to mRNAs. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | family 1 member A1/hRBMY/MGC181956 |
| Tag: | GST |
| Amino Acid Sequence: | YGTSHGAPPARGPRMSYGGSTCHAYSNTRDRYGRSWESYSSCGDFHYCDR EHVCRKDQRNPPSLGRVLPDPREACGSSSYVASIVDGGESRSEKGDSSRY |
| Sequence Similarities: | Contains 1 RRM (RNA recognition motif) domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 257 to 356 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0043 | RBBP4 Polyclonal Antibody | Inquiry |
| EAb-0181 | RBM26 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0047 | Recombinant Human RBBP4 Cell Lysate | Inquiry |
| EL-0216 | Recombinant Human RBBP5 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0118 | Human RBBP7 Knockout Cell Line 5bp deletion | Inquiry |
| Related Gene / Proteins | |||
| RB1 | RbAp46 | RbAp48 | RBB4L |
| RBBP2 | RBBP4 | RBBP5 | RBBP7 |
| RBBP9 | RBM11 | RBM18 | RBM26 |
| RBM3 | RBM34 | RBM38 | RBM39 |
| RBM41 | RBM42 | RBM46 | RBM5 More > |
| RBM7 | RBMS1 | RBMS2 | RBMS3 |
| RBMY1A1 | RBMY1F | RBPJ | RBPMS |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
