Recombinant Human Brd4 protein


  • Specification
  • Related Products
Cat.No.:  PE-2865
Product Name:  Recombinant Human Brd4 protein
Background:  Plays a role in a process governing chromosomal dynamics during mitosis.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  15 kDa including tags
Purity:  >98 % SDS-PAGE.
Species:  Human
Accession#:  O60885
Alternative Names:  Brd4/BRD4-NUT FUSION/BRD4-NUT fusion oncoprotein
Tag:  His
Amino Acid Sequence:  ETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYY KIIKTPMDMGTIKKRLENNYYWNAQECIQDFN TMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETE
Sequence Similarities:  Contains 2 bromo domains.
Expression System:  E. coli
Protein Length:  Protein fragment; 49 to 170
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.