| Cat.No.: | PE-2866 |
| Product Name: | Recombinant Human BRD1/BRL protein (Tagged) |
| Background: | Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. |
| Applications: | SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 41 kDa including tags |
| Purity: | > 95 % SDS-PAGE. |
| Species: | Human |
| Accession#: | O95696 |
| Alternative Names: | BR140-like protein/BRD1/BRD1_HUMAN |
| Amino Acid Sequence: | EQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKH PMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRL RDQGGVVLRQARREVDSIGLEEASG |
| Sequence Similarities: | Contains 1 bromo domain.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain. |
| Expression System: | E. coli |
| Protein Length: | Protein fragment; 556 to 680 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Synthetic Peptides | ||
| SP-0001 | Bromodomain Non-Acetylated Ligand 4 | Inquiry |
| SP-0002 | Bromodomain Non-Acetylated Ligand 3 | Inquiry |
| SP-0003 | Bromodomain Non-Acetylated Ligand 1 | Inquiry |
| SP-0004 | Bromodomain Ligand 3 | Inquiry |
| SP-0006 | Bromodomain Ligand 4 | Inquiry |
| Related Gene / Proteins | |||
| BRCA1 | BRCA2 | BRCC3 | BRD |
| brd1 | brd2 | brd3 | brd4 |
| BRD7 | BRD8 | brd9 | brdt |
| BRL | BRM | BRMS1 | BRPF1 |
| BRPF2 | brpf3 | BRWD1 | BRWD3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
