| Cat.No.: | PE-2885 |
| Product Name: | Recombinant Human MAGOH protein |
| Background: | Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC, that remains bound to spliced mRNAs throughout all stages of mRNA metabolism, functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Remains associated with the mRNA after its export to the cytoplasm and require translation of the mRNA for removal. The heterodimer MAGOH-RBM8A interacts with PYM that function to enhance the translation of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. |
| Applications: | SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 18 kDa including tags |
| Purity: | > 90 % SDS-PAGE. Purified by proprietary chromatographic techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.03% DTT |
| Accession#: | P61326 |
| Alternative Names: | Mago nashi homolog proliferation associated (Drosophila)/Mago nashi protein homolog/magoh |
| Tag: | His |
| Amino Acid Sequence: | MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEA YVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFT TSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPILEHH HHHH |
| Sequence Similarities: | Belongs to the mago nashi family. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 146 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0025 | Human MAGI1 Knockout Cell Line | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0058 | Recombinant Human MAPK8 293 Cell Lysate | Inquiry |
| EL-0059 | Recombinant Human MAPK8 293 Cell Lysate | Inquiry |
| EL-0074 | Recombinant Human MAGEA2 293 Cell Lysate | Inquiry |
| EL-0096 | Recombinant Human MACROD2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| MACROD2 | MAF | MAFF | MAGEA2 |
| MAGI1 | MAGOH | MAK16 | MALT1 |
| MAPK8 | MASH1 | MASP1 | Mat2A |
| MATR3 | MAX | MAZ | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
