Recombinant Human Histones protein (His tag)


  • Specification
  • Related Products
Cat.No.:  PE-2916
Product Name:  Recombinant Human Histones protein (His tag)
Background:  Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  15 kDa including tags
Purity:  > 82 % SDS-PAGE.
Species:  Human
Accession#:  Q16778
Alternative Names:  H1/H1.5/H1F5
Tag:  His
Amino Acid Sequence:  MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVH PDTGISSKAMG IMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTA VRLLLPGELAKHAVSEGTKAVTK YTSSK
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 126
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.