| Cat.No.: | PE-2918 |
| Product Name: | Recombinant Human Histone H1.0 protein |
| Background: | Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 47 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | P07305 |
| Alternative Names: | H1 histone family member 0/H1(0)/H10 |
| Tag: | GST |
| Amino Acid Sequence: | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSI QKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDE PKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKL AATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK |
| Sequence Similarities: | Belongs to the histone H1/H5 family.Contains 1 H15 (linker histone H1/H5 globular) domain. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated on Ser-17 in RNA edited version. |
| Protein Length: | Full length protein; 1 to 194 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Nucleosomes | ||
| NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
| NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
| SP-0010 | Histone H4 peptide (1-21) | Inquiry |
| SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
| Related Gene / Proteins | |||
| HIC1 | HIF1A | HIF1AN | HINFP |
| HIPK1 | HIPK2 | HIRA | Histone |
| Histone H1 | Histone H2A | Histone H2B | Histone H3 |
| Histone H4 | HIV-1 reverse transcriptase | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
