| Cat.No.: | PE-2934 |
| Product Name: | Recombinant Human SET/TAF-I protein |
| Background: | Multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition. Isoform 1 and isoform 2 are potent inhibitors of protein phosphatase 2A. Isoform 1 and isoform 2 inhibit EP300/CREBBP and PCAF-mediated acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins; however, isoform 2 specific activity is higher. |
| Applications: | ELISA; SDS-PAGE; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 56 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl |
| Accession#: | Q01105 |
| Alternative Names: | 2PP2A/HLA DR associated protein II/HLA-DR-associated protein II |
| Amino Acid Sequence: | MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQAS EEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEED EEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGD PSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAG ADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDE EGDEDEGEEDEDDDEGEEGEEDEGEDD |
| Sequence Similarities: | Belongs to the nucleosome assembly protein (NAP) family. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Isoform 2 is phosphorylated on Ser-15 and Thr-23.Isoform 2 is acetylated on Lys-11.Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group.N-terminus of isoform 1 is methylated by METTL11A/NTM1. Mainly trimethylated. |
| Protein Length: | Full length protein; 1 to 277 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0017 | TAF1 Polyclonal Antibody | Inquiry |
| EAb-0030 | SETD8 Polyclonal Antibody | Inquiry |
| EAb-0031 | SETDB1 Polyclonal Antibody | Inquiry |
| EAb-0032 | Setd1a Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| Related Gene / Proteins | |||
| SENP3 | SENP8 | SET | SET1 |
| SET2 | SET7 | SET8 | SET9 |
| SETBP1 | SETD1A | SETD1B | SETD2 |
| SETD3 | SETD5 | SETD6 | SETD7 |
| SETD8 | SETD9 | SetDB1 | SETDB2 More > |
| SETMAR | TADA1 | TADA1L | TADA2A |
| TADA2B | TADA3 | TAE1 | TAF-I |
| taf1 | TAF1L | TAF6L | TAF7 |
| TAF7L | TAL1 | TAP2 | TAZ |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
