Recombinant Human mH2A2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2943
Product Name:  Recombinant Human mH2A2 protein
Background:  Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in stable X chromosome inactivation.
Applications:  ELISA; SDS-PAGE; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  67 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  Q9P0M6
Alternative Names:  Core histone macro H2A2.2/Core histone macro-H2A.2/Core histone macroH2A2.2
Amino Acid Sequence:  MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMA AVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTI ASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSK AAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLT QSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRK SQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSA AEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVY FLLFDSESIGIYVQEMAKLDAK
Sequence Similarities:  Contains 1 histone H2A domain.Contains 1 Macro domain.
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 372
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.