Recombinant Human MeCP2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2961
Product Name:  Recombinant Human MeCP2 protein
Background:  Chromosomal protein that binds to methylated DNA. It can bind specifically to a single methyl-CpG pair. It is not influenced by sequences flanking the methyl-CpGs. Mediates transcriptional repression through interaction with histone deacetylase and the corepressor SIN3A.
Applications:  SDS-PAGE; ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  36 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.79% Tris HCl, 0.31% Glutathione
Accession#:  P51608
Alternative Names:  AUTSX 3/AUTSX3/DKFZp686A24160
Tag:  GST
Amino Acid Sequence:  PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGK AFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ
Sequence Similarities:  Contains 2 A.T hook DNA-binding domains.Contains 1 MBD (methyl-CpG-binding) domain.
Expression System:  Wheat germ
Post Translational Modifications:  Phosphorylated on Ser-423 in brain upon synaptic activity, which attenuates its repressor activity and seems to regulate dendritic growth and spine maturation.
Protein Length:  Protein fragment; 81 to 170
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.