Cat.No.: | PE-2961 |
Product Name: | Recombinant Human MeCP2 protein |
Background: | Chromosomal protein that binds to methylated DNA. It can bind specifically to a single methyl-CpG pair. It is not influenced by sequences flanking the methyl-CpGs. Mediates transcriptional repression through interaction with histone deacetylase and the corepressor SIN3A. |
Applications: | SDS-PAGE; ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 36 kDa including tags |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.31% Glutathione |
Accession#: | P51608 |
Alternative Names: | AUTSX 3/AUTSX3/DKFZp686A24160 |
Tag: | GST |
Amino Acid Sequence: | PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGK AFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ |
Sequence Similarities: | Contains 2 A.T hook DNA-binding domains.Contains 1 MBD (methyl-CpG-binding) domain. |
Expression System: | Wheat germ |
Post Translational Modifications: | Phosphorylated on Ser-423 in brain upon synaptic activity, which attenuates its repressor activity and seems to regulate dendritic growth and spine maturation. |
Protein Length: | Protein fragment; 81 to 170 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0043 | Recombinant Human MECP2 293 Cell Lysate | Inquiry |
EL-0111 | Recombinant Human MEF2B Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0067 | MeCP2 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0109 | Human MECP2 Knockout Cell Line 1bp insertion | Inquiry |
CL-0110 | Human MEN1 Knockout Cell Line 1bp insertion | Inquiry |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools