Recombinant TAE1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2982
Product Name:  Recombinant TAE1 protein
Background:  Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif. Responsible for the N-terminal methylation of the ribosomal proteins RPL12A, RPL12B, RPS25A and RPS25B.
Applications:  SDS-PAGE; HPLC
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Lyophilised
Molecular Weight:  26 kDa
Purity:  > 95 % as determined by SEC-HPLC and reducing SDS-PAGE.
Species:  Saccharomyces cerevisiae
Formulation:  pH: 7.40; Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride
Accession#:  P38340
Alternative Names:  Alpha N-terminal protein methyltransferase 1/NTM1/TAE1
Amino Acid Sequence:  MDVPADSHIKYEDAIDYWTDVDATVDGVLGGYGEGTVVPTMDVLGSNNFL RKLKSRMLPQENNVKYAVDIGAGIGRVSKTMLHKHAAKIDLVEPVKPFIE QMHVELAELKDKGQIGQIYEVGMQDWTPDAGKYWLIWCQWCVGHLPDAEL VAFLKRCIVGLQPNGTIVVKENNTPTDTDDFDETDSSVTRSDAKFRQIFE EAGLKLIASERQRGLPRELYPVRMYALKPMPN
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 232
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.