| Cat.No.: | PE-2986 |
| Product Name: | Recombinant Human HEMK2/N6AMT1 protein |
| Background: | The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. |
| Applications: | SDS-PAGE; Mass Spectrometry |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 25 kDa including tags |
| Purity: | > 85 % SDS-PAGE. Purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20 mM Tris pH 7.5, 2 mM EDTA. |
| Species: | Human |
| Formulation: | pH: 7.40; Constituents: 79% PBS, 20% Glycerol, 0.02% DTT |
| Accession#: | Q9Y5N5 |
| Alternative Names: | C21orf127/Chromosome 21 open reading frame 127/EC 2.1.1.- |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGSMAGENFATPFHGHVGRGAFSDVYEPAE DTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTD INPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVV TPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKEN NPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 214 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0661 | N6AMT2 Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-0662 | N6AMT2 Polyclonal Antibody | Inquiry |
| EAb-0663 | N6AMT2 Polyclonal Antibody, FITC Conjugated | Inquiry |
| EAb-0664 | N6AMT2 Polyclonal Antibody, Biotin Conjugated | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2964 | Recombinant Human N6AMT2 protein | Inquiry |
| Related Gene / Proteins | |||
| N6AMT1 | N6AMT2 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
