Cat.No.: | PE-2990 |
Product Name: | Recombinant Human METTL2B protein |
Background: | This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | FLJ11350/methyltransferase like 2/Methyltransferase like 2B |
Tag: | GST |
Amino Acid Sequence: | SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTP PVEENVTQKISDLEICAD |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 41 to 108 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0043 | Recombinant Human MECP2 293 Cell Lysate | Inquiry |
EL-0111 | Recombinant Human MEF2B Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0067 | MeCP2 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0109 | Human MECP2 Knockout Cell Line 1bp insertion | Inquiry |
CL-0110 | Human MEN1 Knockout Cell Line 1bp insertion | Inquiry |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools