| Cat.No.: | PE-2993 |
| Product Name: | Recombinant Human N6AMT2 protein |
| Background: | Putative DNA methyltransferase. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | ESP13/N 6 adenine specific DNA methyltransferase 2 (putative)/N(6) adenine specific DNA methyltransferase 2 |
| Tag: | GST |
| Amino Acid Sequence: | MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQL SQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIY IFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECL RKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEF RCYVNYDSGLDCGI |
| Sequence Similarities: | Belongs to the methyltransferase superfamily. AML1 family. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 214 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0661 | N6AMT2 Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-0662 | N6AMT2 Polyclonal Antibody | Inquiry |
| EAb-0663 | N6AMT2 Polyclonal Antibody, FITC Conjugated | Inquiry |
| EAb-0664 | N6AMT2 Polyclonal Antibody, Biotin Conjugated | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2964 | Recombinant Human N6AMT2 protein | Inquiry |
| Related Gene / Proteins | |||
| N6AMT1 | N6AMT2 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
