SIRT6 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-0429
Product Name:  SIRT6 Polyclonal Antibody
Antibody Type:  Polyclonal
Immunogen:  This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHL
Host:  Rabbit
Isotype:  IgG
Antibody Target:  SIRT6
Specificity:  Specificity of human SIRT6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification:  Affinity purified
Appearance:  Liquid
Formulation:  PBS (pH 7.2) and 40% Glycerol
Applications:  ICC/IF
Recommended Dilutions/Conditions:  Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Species Reactivity:  Human, Mouse, Rat
Storage:  -20°C
Storage Buffer:  0.02% Sodium Azide
Warning:  For Research Use Only! Not For Use in Humans.
Alternative Name:  EC 3.5.1.-; NAD-dependent deacetylase sirtuin-6; SIR2L6sir2-related protein type 6; SIR2-like protein 6; sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae); sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 6; sirtuin 6; sirtuin type 6

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.