Cat.No.: | EAb-0458 |
Product Name: | LSD1 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY |
Host: | Rabbit |
Isotype: | IgG |
Antibody Target: | KDM1A |
Specificity: | Specificity of human LSD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Purification: | Affinity purified |
Appearance: | Liquid |
Formulation: | PBS (pH 7.2) and 40% Glycerol |
Applications: | ICC/IF |
Recommended Dilutions/Conditions: |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20°C |
Storage Buffer: | 0.02% Sodium Azide |
Warning: | For Research Use Only! Not For Use in Humans. |
Alternative Name: | amine oxidase (flavin containing) domain 2; AOF2; AOF2lysine-specific histone demethylase 1; BHC110; BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit; Flavin-containing amine oxidase domain-containing protein 2; KIAA0601KDM1; LSD1; LSD1BRAF35-HDAC complex protein BHC110; lysine (K)-specific demethylase 1; Lysine (K)specific Demethylase 1A; Lysine (K)-specific Demethylase 1A; lysine-specific histone demethylase 1A |
Product Types | ||
◆ Research Kits | ||
EKIT-0062 | Histone Demethylase LSD1 Activity/Inhibition Assay Kit | Inquiry |
EKIT-0126 | LSD1 Inhibitor Screening Assay Kit | Inquiry |
EKIT-0160 | LSD1 Demethylase Activity/Inhibition Fluorometric Assay Kit | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0111 | DDP-38003 dihydrochloride | Inquiry |
BSM-0141 | GSK-LSD1 dihydrochloride | Inquiry |
Related Gene / Proteins | |||
LSD1 | LSD2 | LSM2 | LSM3 |
LSM5 | LSM6 | LSP1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools