Cat.No.: | EAb-2489 |
Product Name: | KMT6/EZH2 Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect KMT6/EZH2 |
Antibody Type: | Polyclonal |
Immunogen: | Synthetic peptide within Human KMT6/ EZH2 aa 696-746. |
Immunogen Sequence: | YAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEI P |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Immunogen affinity purified |
Appearance: | Liquid |
Formulation: | 0.09% Sodium azide, 99% Tris citrate/phosphatepH 7-8 |
Applications: | WB, IP, IHC-P |
Species Reactivity: | Mouse, Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Q15910; CAA64955.1 |
Alternative Name: | Enhancer of zeste 2 antibody/enhancer of zeste 2 polycomb repressive complex 2 subunit antibody/Enhancer of zeste homolog 2 (Drosophila) antibody |
Scientific Background: | Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Compared to EZH2-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1, CDKN2A and retinoic acid target genes. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0006 | GSK343 | Inquiry |
BSM-0059 | 3-Deazaneplanocin A | Inquiry |
BSM-0060 | 3-Deazaneplanocin A hydrochloride | Inquiry |
◆ Extracts & Lysates | ||
EL-0024 | Recombinant Human EZH1 293 Cell Lysate | Inquiry |
EL-0025 | Recombinant Human EZH2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
ezh1 | EZH2 | KMT1B | KMT1E |
KMT2A | KMT2B | KMT2C | KMT2D |
KMT2E | KMT3A | KMT3B | KMT3C |
KMT5A | KMT6 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools